Calcitonin (human) trifluoroacetate salt
H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH₂ trifluoroacetate salt (Disulfide bond)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-719 | 1mg | 140.00 | + Add to cart |
|
R-M-719 | 5mg | 590.00 | + Add to cart |
|
|
Product description
Calcitonin (human) trifluoroacetate salt ,CAS : 21215-62-3 from ruixi.Calcitonin is a peptide hormone involved in calcium and phosphorus homeostasis. Its inhibitory effect on osteoclast activity lowers blood calcium levels and positively influences bone mass density.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 21215-62-3 |
Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH₂ |
Molecular Formula | C₁₅₁H₂₂₆N₄₀O₄₅S₃ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product